CacheBy
Atlas Antibodies Anti-DDX41 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX41 Antibody

상품 한눈에 보기

인간 DDX41 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017911-100 Anti-DDX41 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017911-25 Anti-DDX41 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX41 Antibody

Anti-DDX41 Antibody

Target Protein: DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human DDX41


Alternative Gene Names

  • ABS
  • MGC8828

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000012771 95%
Mouse ENSMUSG00000021494 93%

Technical Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.