CacheBy
Atlas Antibodies Anti-RTF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTF1 Antibody

상품 한눈에 보기

인간 RTF1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성으로 마우스 및 랫과 99% 이상 동일. 40% 글리세롤 PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA006714-100 Anti-RTF1 Antibody, Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006714-25 Anti-RTF1 Antibody, Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTF1 Antibody

Anti-RTF1 Antibody

Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RTF1.

Alternative Gene Names

  • KIAA0252

Open Datasheet

Target Information

항목 내용
Target Protein Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
Target Gene RTF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027304 (100%), Rat ENSRNOG00000005183 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.