CacheBy
Atlas Antibodies Anti-RSU1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSU1 Antibody

상품 한눈에 보기

Human RSU1 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC에 적합합니다. 높은 종 간 반응성(인간, 생쥐, 랫트) 보유. PrEST 항원으로 정제되어 신뢰성 높은 결과 제공. 40% glycerol 기반 PBS buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA025927-100 Anti-RSU1 Antibody, Ras suppressor protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025927-25 Anti-RSU1 Antibody, Ras suppressor protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSU1 Antibody

Anti-RSU1 Antibody

Target Information

  • Target Protein: Ras suppressor protein 1
  • Target Gene: RSU1
  • Alternative Gene Names: FLJ31034, RSP-1
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human RSU1.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    DLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKN

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000026727 99%
Rat ENSRNOG00000017595 96%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Base Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.