CacheBy
Atlas Antibodies Anti-RSF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSF1 Antibody

상품 한눈에 보기

Human RSF1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인체, 마우스, 랫트 간 교차 반응성이 확인되었습니다. ICC 등 다양한 연구 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046129-100 Anti-RSF1 Antibody, remodeling and spacing factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046129-25 Anti-RSF1 Antibody, remodeling and spacing factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSF1 Antibody

Anti-RSF1 Antibody

Target: Remodeling and Spacing Factor 1 (RSF1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human RSF1.

Alternative Gene Names

HBXAP, p325, RSF-1, XAP8

Open Datasheet


Target Information

  • Target Protein: Remodeling and spacing factor 1
  • Target Gene: RSF1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000035623 100%
Rat ENSRNOG00000024194 99%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Immunocytochemistry (ICC)


제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.