CacheBy
Atlas Antibodies Anti-RSF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSF1 Antibody

상품 한눈에 보기

인간 RSF1 단백질을 인식하는 토끼 폴리클로날 항체로, 리모델링 및 스페이싱 인자 연구에 적합합니다. 고순도 친화 정제 방식으로 제조되었으며, 인체, 마우스, 랫트에 높은 반응성을 보입니다. 면역염색 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064567-100 Anti-RSF1 Antibody, remodeling and spacing factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064567-25 Anti-RSF1 Antibody, remodeling and spacing factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSF1 Antibody

Anti-RSF1 Antibody

Target: Remodeling and Spacing Factor 1 (RSF1)
Type: Polyclonal Antibody against Human RSF1
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody raised in rabbit against human RSF1 (remodeling and spacing factor 1). Suitable for various immunological applications.


Alternative Gene Names

HBXAP, p325, RSF-1, XAP8


Target Information

  • Target Protein: Remodeling and spacing factor 1
  • Target Gene: RSF1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000035623): 100%
  • Rat (ENSRNOG00000024194): 99%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Supporting Documents

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.