CacheBy
Atlas Antibodies Anti-RP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RP2 Antibody

상품 한눈에 보기

Human RP2 단백질을 인식하는 rabbit polyclonal 항체로, Western blot 및 IHC에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, retinitis pigmentosa 2 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000234-100 Anti-RP2 Antibody, retinitis pigmentosa 2 (X-linked recessive) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000234-25 Anti-RP2 Antibody, retinitis pigmentosa 2 (X-linked recessive) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RP2 Antibody

Anti-RP2 Antibody

Target Protein: retinitis pigmentosa 2 (X-linked recessive)
Product Type: Polyclonal Antibody against Human RP2


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

This polyclonal antibody is raised in rabbit against the human RP2 protein. It is affinity purified using the PrEST antigen, ensuring high specificity and reproducibility.


Alternative Gene Names

  • NM23-H10
  • NME10
  • TBCCD2

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000060090 88%
Rat ENSRNOG00000025428 87%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.