CacheBy
Atlas Antibodies Anti-RP11-849H4.2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RP11-849H4.2 Antibody

상품 한눈에 보기

인간 RP11-849H4.2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit에서 생산된 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. PBS/glycerol 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051121-100 Anti-RP11-849H4.2 Antibody, Putative short transient receptor potential channel 2-like protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051121-25 Anti-RP11-849H4.2 Antibody, Putative short transient receptor potential channel 2-like protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RP11-849H4.2 Antibody

Anti-RP11-849H4.2 Antibody

Target: Putative short transient receptor potential channel 2-like protein
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RP11-849H4.2.

Open Datasheet (PDF)

Target Information

  • Protein: Putative short transient receptor potential channel 2-like protein
  • Gene: RP11-849H4.2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000070425 56%
Rat ENSRNOG00000020188 28%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.