
원본
Thermo Fisher Scientific HSPA2 Polyclonal Antibody
상품 한눈에 보기
HSPA2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 01:12
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579408 HSPA2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific HSPA2 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg / 1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564–598aa, KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746524 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Hsp70 단백질군은 다른 샤페론과 협력하여 단백질의 응집을 방지하고, 새로 번역된 폴리펩타이드의 접힘을 매개합니다. 이들은 비자연적 단백질 구조를 인식하여 세포질 및 세포소기관 내에서 단백질 안정화, 번역 중 또는 스트레스 유발 손상 후의 단백질 복구 과정에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
