CacheBy
Thermo Fisher Scientific HSPA2 Polyclonal Antibody
원본

Thermo Fisher Scientific HSPA2 Polyclonal Antibody

상품 한눈에 보기

HSPA2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 01:12
Thermo Fisher Scientific PA579408 HSPA2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific HSPA2 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunohistochemistry (Frozen) (IHC-F) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg / 1×10⁶ cells

Product Specifications

Item Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564–598aa, KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746524

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

Hsp70 단백질군은 다른 샤페론과 협력하여 단백질의 응집을 방지하고, 새로 번역된 폴리펩타이드의 접힘을 매개합니다. 이들은 비자연적 단백질 구조를 인식하여 세포질 및 세포소기관 내에서 단백질 안정화, 번역 중 또는 스트레스 유발 손상 후의 단백질 복구 과정에 관여합니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.