
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DDX1 Antibody
상품 한눈에 보기
Human DDX1 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 실험에 적합하며, 독립 항체 간 교차 검증으로 높은 신뢰도의 단백질 발현 검증 가능. PrEST 항원을 이용해 친화 정제된 고품질 항체.
- 카탈로그번호
- HPA034503-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034503-100 Anti-DDX1 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034503-25 Anti-DDX1 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DDX1 Antibody
Anti-DDX1 Antibody
DEAD (Asp-Glu-Ala-Asp) box helicase 1
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human DDX1.
Alternative Gene Names
- DBP-RB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DEAD (Asp-Glu-Ala-Asp) box helicase 1 |
| Target Gene | DDX1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000037149 | 96% |
| Rat | ENSRNOG00000006652 | 94% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



