CacheBy
Atlas Antibodies Anti-DDX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX1 Antibody

상품 한눈에 보기

Human DDX1 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 실험에 적합하며, 독립 항체 간 교차 검증으로 높은 신뢰도의 단백질 발현 검증 가능. PrEST 항원을 이용해 친화 정제된 고품질 항체.

카탈로그번호
HPA034503-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034503-100 Anti-DDX1 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034503-25 Anti-DDX1 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX1 Antibody

Anti-DDX1 Antibody

DEAD (Asp-Glu-Ala-Asp) box helicase 1

  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human DDX1.

Alternative Gene Names

  • DBP-RB

Open Datasheet

Target Information

항목 내용
Target Protein DEAD (Asp-Glu-Ala-Asp) box helicase 1
Target Gene DDX1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000037149 96%
Rat ENSRNOG00000006652 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.