Atlas Antibodies Anti-DDX1 Antibody

상품 한눈에 보기

Human DDX1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립 항체 비교를 통한 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA034502-100 Anti-DDX1 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA034502-25 Anti-DDX1 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: DEAD (Asp-Glu-Ala-Asp) box helicase 1
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against Human DDX1

Alternative Gene Names: DBP-RB
Target Gene: DDX1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand