
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DAZL Antibody
상품 한눈에 보기
인체 DAZL 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 사람에서 반응성이 확인되었으며, 고품질 단백질 발현 검증에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019777-100 Anti-DAZL Antibody, deleted in azoospermia-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019777-25 Anti-DAZL Antibody, deleted in azoospermia-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DAZL Antibody
Anti-DAZL Antibody
Target: deleted in azoospermia-like (DAZL)
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human DAZL.
Alternative Gene Names
DAZH, DAZL1, DAZLA, MGC26406, SPGYLA
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | deleted in azoospermia-like |
| Target Gene | DAZL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000023474 (84%), Mouse ENSMUSG00000010592 (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



