Atlas Antibodies Anti-DBH Antibody

상품 한눈에 보기

Human DBH 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 및 Orthogonal validation에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 대한 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA002130-100 Anti-DBH Antibody, dopamine beta-hydroxylase (dopamine beta-monooxygenase) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA002130-25 Anti-DBH Antibody, dopamine beta-hydroxylase (dopamine beta-monooxygenase) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human DBH

항목	내용
Target Protein	dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Target Gene	DBH
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (72%), Rat (70%)

VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand