CacheBy
Atlas Antibodies Anti-CXorf56 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CXorf56 Antibody

상품 한눈에 보기

Human CXorf56 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 다양한 연구 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064831-100 Anti-CXorf56 Antibody, chromosome X open reading frame 56 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064831-25 Anti-CXorf56 Antibody, chromosome X open reading frame 56 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CXorf56 Antibody

Anti-CXorf56 Antibody

Target: chromosome X open reading frame 56 (CXorf56)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human CXorf56.


Alternative Gene Names

  • FLJ22965

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome X open reading frame 56
Target Gene CXorf56
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCNTEDE

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Mouse ENSMUSG00000006423 (100%)
    • Rat ENSRNOG00000012564 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.