CacheBy
Atlas Antibodies Anti-CXorf56 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CXorf56 Antibody

상품 한눈에 보기

인간 CXorf56 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간에서 검증되었으며 마우스, 랫에서도 높은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038617-100 Anti-CXorf56 Antibody, chromosome X open reading frame 56 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038617-25 Anti-CXorf56 Antibody, chromosome X open reading frame 56 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CXorf56 Antibody

Anti-CXorf56 Antibody

Target: chromosome X open reading frame 56 (CXorf56)
Type: Polyclonal Antibody against Human CXorf56
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody raised in rabbit against the human CXorf56 protein. Validated for IHC and WB applications.


Alternative Gene Names

  • FLJ22965

Target Information

항목 내용
Target Protein chromosome X open reading frame 56
Target Gene CXorf56
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCNTEDE

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000006423 100%
Rat ENSRNOG00000012564 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.