CacheBy
Atlas Antibodies Anti-CXorf21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CXorf21 Antibody

상품 한눈에 보기

Human CXorf21 단백질을 인식하는 Rabbit Polyclonal Antibody입니다. IHC 등 다양한 연구 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 서열 동일성(84%)을 보여 인체 관련 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001185-100 Anti-CXorf21 Antibody, chromosome X open reading frame 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001185-25 Anti-CXorf21 Antibody, chromosome X open reading frame 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CXorf21 Antibody

Anti-CXorf21 Antibody

Target: Chromosome X open reading frame 21 (CXorf21)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CXorf21.


Alternative Gene Names

  • FLJ11577

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome X open reading frame 21
Target Gene CXorf21
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025058 (84%)
Rat ENSRNOG00000003748 (84%)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EIPLPMEDSISTQPSDFPQKPIQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDTVFHDSSPTQILASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMST

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.