
원본
Atlas Antibodies Anti-CXCR2 Antibody
상품 한눈에 보기
Human CXCR2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교하여 확인함. PrEST 항원을 이용해 Affinity 정제되었으며, Human에 반응함. CXCR2, IL8RB, CD182 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA032017-100 Anti-CXCR2 Antibody, chemokine (C-X-C motif) receptor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032017-25 Anti-CXCR2 Antibody, chemokine (C-X-C motif) receptor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CXCR2 Antibody
Anti-CXCR2 Antibody
Target: chemokine (C-X-C motif) receptor 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CXCR2
Alternative Gene Names
CD182, CMKAR2, IL8RB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chemokine (C-X-C motif) receptor 2 |
| Target Gene | CXCR2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026180 (46%), Rat ENSRNOG00000014269 (43%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



