Atlas Antibodies Anti-CSK Antibody

상품 한눈에 보기

Human CSK 단백질을 인식하는 토끼 폴리클로날 항체로, c-src tyrosine kinase 연구에 적합. IHC 등 다양한 응용 가능. PrEST 항원을 이용해 친화 정제. 인체 및 설치류에서 높은 반응성 확인. 안정한 PBS/glycerol 버퍼에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028425-100 Anti-CSK Antibody, c-src tyrosine kinase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028425-25 Anti-CSK Antibody, c-src tyrosine kinase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: c-src tyrosine kinase
Target Gene: CSK
Verified Species Reactivity: Human
Interspecies Information:
- Mouse (ENSMUSG00000032312) – 100% identity
- Rat (ENSRNOG00000019374) – 100% identity

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQ

Polyclonal antibody against human CSK (c-src tyrosine kinase).
Recommended for immunohistochemistry and related applications.
Open Datasheet

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Determine optimal concentrations and conditions experimentally.