CacheBy
Atlas Antibodies Anti-CSK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CSK Antibody

상품 한눈에 보기

Human CSK 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이도 제공. IHC 등 다양한 응용에 적합. 40% glycerol 기반 안정화 버퍼 포함. Human, Mouse, Rat에 반응 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026488-100 Anti-CSK Antibody, c-src tyrosine kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026488-25 Anti-CSK Antibody, c-src tyrosine kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CSK Antibody

Anti-CSK Antibody

Target Information

  • Target Protein: c-src tyrosine kinase
  • Target Gene: CSK
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
QDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000032312 (100%)
  • Rat ENSRNOG00000019374 (100%)

Product Description

Polyclonal antibody against Human CSK.

  • Immunohistochemistry (IHC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.