
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CSK Antibody
상품 한눈에 보기
Human CSK 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이도 제공. IHC 등 다양한 응용에 적합. 40% glycerol 기반 안정화 버퍼 포함. Human, Mouse, Rat에 반응 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026488-100 Anti-CSK Antibody, c-src tyrosine kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026488-25 Anti-CSK Antibody, c-src tyrosine kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CSK Antibody
Anti-CSK Antibody
Target Information
- Target Protein: c-src tyrosine kinase
- Target Gene: CSK
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
QDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQ
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032312 (100%)
- Rat ENSRNOG00000019374 (100%)
Product Description
Polyclonal antibody against Human CSK.
Recommended Applications
- Immunohistochemistry (IHC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



