CacheBy
Atlas Antibodies Anti-RITA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RITA1 Antibody

상품 한눈에 보기

Human RITA1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 재현성을 제공. Human에 특이적으로 반응하며 Mouse, Rat과 부분적 교차 반응성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061531-100 Anti-RITA1 Antibody, RBPJ interacting and tubulin associated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061531-25 Anti-RITA1 Antibody, RBPJ interacting and tubulin associated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RITA1 Antibody

Anti-RITA1 Antibody

RBPJ interacting and tubulin associated 1

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal antibody against Human RITA1.

Alternative Gene Names

C12orf52, FLJ14827, RITA

Open Datasheet

Target Information

  • Target Protein: RBPJ interacting and tubulin associated 1
  • Target Gene: RITA1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPST

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000029600): 59%
  • Rat (ENSRNOG00000037720): 56%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.