AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RIT1 Antibody
상품 한눈에 보기
Human RIT1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 등 다양한 응용에 적합. 고순도의 Affinity purified 제품이며, 40% glycerol buffer로 안정화되어 있음. 인간과 높은 상동성을 가진 마우스 및 랫트에서도 반응 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053249-100 Anti-RIT1 Antibody, Ras-like without CAAX 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053249-25 Anti-RIT1 Antibody, Ras-like without CAAX 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RIT1 Antibody
Anti-RIT1 Antibody
Target Information
- Protein Name: Ras-like without CAAX 1
- Gene Name: RIT1
- Alternative Gene Names: MGC125864, MGC125865, RIBB, RIT, ROC1
Product Description
Polyclonal antibody against human RIT1 protein.
Recommended for applications such as Western blot (WB).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000028057): 93%
- Rat (ENSRNOG00000020232): 91%
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.