
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RIMBP3 Antibody
상품 한눈에 보기
Human RIMBP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 분석에 적합합니다. RNA-seq 데이터와의 정합을 통한 정교한 단백질 발현 검증을 제공합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001183-100 Anti-RIMBP3 Antibody, RIMS binding protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001183-25 Anti-RIMBP3 Antibody, RIMS binding protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RIMBP3 Antibody
Anti-RIMBP3 Antibody
RIMS binding protein 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human RIMBP3
Alternative Gene Names
KIAA1666, RIMBP3.1, RIMBP3A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RIMS binding protein 3 |
| Target Gene | RIMBP3 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | RDTASEVDDLEPDSVSLALEMGGSAAPAAPKLKIFMAQYNYNPFEGPNDHPEGELPLTAGDYIYIFGDMDEDGFYEGELEDGRRGLVPSNFVEQIPDSYIPGCLPAKSPDLGPSQLPAGQDEALEE |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000071636 | 65% |
| Rat | ENSRNOG00000030452 | 63% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



