CacheBy
Atlas Antibodies Anti-RIIAD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RIIAD1 Antibody

상품 한눈에 보기

Human RIIAD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 기반 직교 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공하며, 다양한 조직 발현 비교 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045703-100 Anti-RIIAD1 Antibody, regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045703-25 Anti-RIIAD1 Antibody, regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RIIAD1 Antibody

Anti-RIIAD1 Antibody

Target: regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human RIIAD1


Alternative Gene Names

C1orf230, FLJ36032, NCRNA00166

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
Target Gene RIIAD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000037310 (79%), Mouse ENSMUSG00000028139 (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.