CacheBy
Atlas Antibodies Anti-RICTOR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RICTOR Antibody

상품 한눈에 보기

RICTOR 단백질을 인식하는 토끼 폴리클로날 항체로, 인간 시료에 반응합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 적합합니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037803-100 Anti-RICTOR Antibody, RPTOR independent companion of MTOR, complex 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037803-25 Anti-RICTOR Antibody, RPTOR independent companion of MTOR, complex 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RICTOR Antibody

Anti-RICTOR Antibody

RPTOR independent companion of MTOR, complex 2


면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.


Product Description

Polyclonal antibody against Human RICTOR


Alternative Gene Names

AVO3, KIAA1999, MGC39830, PIA

Open Datasheet


Target Information

항목 내용
Target Protein RPTOR independent companion of MTOR, complex 2
Target Gene RICTOR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDK
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011341 (96%), Mouse ENSMUSG00000050310 (95%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.