CacheBy
Atlas Antibodies Anti-RIC8B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RIC8B Antibody

상품 한눈에 보기

Human RIC8B 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 사람에 특이적으로 반응하며, 마우스 및 랫과 높은 서열 유사성 보유. PBS와 글리세롤 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039970-100 Anti-RIC8B Antibody, RIC8 guanine nucleotide exchange factor B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039970-25 Anti-RIC8B Antibody, RIC8 guanine nucleotide exchange factor B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RIC8B Antibody

Anti-RIC8B Antibody

Target: RIC8 guanine nucleotide exchange factor B
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RIC8B.


Alternative Gene Names

FLJ10620, hSyn, RIC8

Open Datasheet


Target Information

  • Target Protein: RIC8 guanine nucleotide exchange factor B
  • Target Gene: RIC8B

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000035620 94%
Rat ENSRNOG00000007323 91%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.