CacheBy
Atlas Antibodies Anti-RGL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RGL3 Antibody

상품 한눈에 보기

인간 RGL3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 발현 검증 완료 제품이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 유사성을 보여 신뢰성 있는 결과 제공.

카탈로그번호
HPA043615-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043615-100 Anti-RGL3 Antibody, ral guanine nucleotide dissociation stimulator-like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043615-25 Anti-RGL3 Antibody, ral guanine nucleotide dissociation stimulator-like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RGL3 Antibody

Anti-RGL3 Antibody

Target: ral guanine nucleotide dissociation stimulator-like 3 (RGL3)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human RGL3.

Alternative Gene Names

  • FLJ32585

Open Datasheet

Target Information

항목 내용
Target Protein ral guanine nucleotide dissociation stimulator-like 3
Target Gene RGL3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (89%), Rat (88%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence:
RRKEWEILARIQQLQRRCQSYTLSPHPPILAALHAQNQLTEEQSYRLSRVIEPPAASCPSSPRIRRRISLTKRLSAKLAREKSSSPSGSPGDPSSPTSSVSPGS

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.