Atlas Antibodies Anti-RGL3 Antibody

상품 한눈에 보기

Human RGL3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. 재조합 단백질 기반 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 대한 반응성이 검증됨. 다양한 생명과학 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042763-100 Anti-RGL3 Antibody, ral guanine nucleotide dissociation stimulator-like 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042763-25 Anti-RGL3 Antibody, ral guanine nucleotide dissociation stimulator-like 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ral guanine nucleotide dissociation stimulator-like 3 (RGL3)
Supplier: Atlas Antibodies

Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody against human RGL3.

항목	내용
Target Protein	ral guanine nucleotide dissociation stimulator-like 3
Target Gene	RGL3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RRKEWEILARIQQLQRRCQSYTLSPHPPILAALHAQNQLTEEQSYRLSRVIEPPAASCPSSPRIRRRISLTKRLSAKLAREKSSSPSGSPGDPSSPTSSVSPGS

항목	내용
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000040146 (89%), Rat ENSRNOG00000013027 (88%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand