Atlas Antibodies Anti-REXO1 Antibody

상품 한눈에 보기

Human REXO1을 표적으로 하는 고품질 폴리클로날 항체. Western blot 및 IHC에 적합하며 독립 항체 간 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제됨. Human 반응성 검증 및 Mouse, Rat과 높은 서열 유사성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042552-100 Anti-REXO1 Antibody, REX1, RNA exonuclease 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042552-25 Anti-REXO1 Antibody, REX1, RNA exonuclease 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

REX1, RNA exonuclease 1 homolog (S. cerevisiae)

Validation of protein expression in WB
Comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human REXO1

EloA-BP1, KIAA1138, TCEB3BP1

항목	내용
Target Protein	REX1, RNA exonuclease 1 homolog (S. cerevisiae)
Target Gene	REXO1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000047417 (72%), Rat ENSRNOG00000017916 (70%)

Antigen Sequence:
PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand