Atlas Antibodies Anti-REXO1 Antibody

상품 한눈에 보기

Human REXO1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었으며, 마우스 및 랫과도 높은 상동성을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042155-100 Anti-REXO1 Antibody, REX1, RNA exonuclease 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042155-25 Anti-REXO1 Antibody, REX1, RNA exonuclease 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

REX1, RNA exonuclease 1 homolog (S. cerevisiae)

Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human REXO1

EloA-BP1, KIAA1138, TCEB3BP1

항목	내용
Target Protein	REX1, RNA exonuclease 1 homolog (S. cerevisiae)
Target Gene	REXO1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000047417 (72%), Rat ENSRNOG00000017916 (70%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand