CacheBy
Atlas Antibodies Anti-REXO2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-REXO2 Antibody

상품 한눈에 보기

인간 REXO2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 토끼 IgG 항체로 고순도 확보. RNA-seq 데이터 기반 직교 검증 완료. 40% 글리세롤 및 PBS 완충액 내 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038450-100 Anti-REXO2 Antibody, RNA exonuclease 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038450-25 Anti-REXO2 Antibody, RNA exonuclease 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-REXO2 Antibody

Anti-REXO2 Antibody

Target: RNA exonuclease 2


  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human REXO2.


Alternative Gene Names

CGI-114, DKFZP566E144, SFN

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RNA exonuclease 2
Target Gene REXO2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
Verified Species Reactivity Human
Interspecies Identity Rat (96%), Mouse (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.