
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RFC2 Antibody
상품 한눈에 보기
Human RFC2 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 실험에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat 종에 반응하며 40% glycerol PBS buffer로 안정화되어 있습니다.
- 카탈로그번호
- HPA029493-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029493-100 Anti-RFC2 Antibody, replication factor C (activator 1) 2, 40kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029493-25 Anti-RFC2 Antibody, replication factor C (activator 1) 2, 40kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RFC2 Antibody
Anti-RFC2 Antibody
Target Protein: replication factor C (activator 1) 2, 40kDa
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human RFC2
Alternative Gene Names
A1, RFC40
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | replication factor C (activator 1) 2, 40kDa |
| Target Gene | RFC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000023104 (90%), Rat ENSRNOG00000001457 (90%) |
Antigen Sequence
PAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASND
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



