CacheBy
Atlas Antibodies Anti-RELT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RELT Antibody

상품 한눈에 보기

Human RELT 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot(WB) 및 Immunocytochemistry(ICC)에 적합. RELT tumor necrosis factor receptor 연구용. 고순도 Affinity 정제 및 Human에 대한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071518-100 Anti-RELT Antibody, RELT tumor necrosis factor receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071518-25 Anti-RELT Antibody, RELT tumor necrosis factor receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RELT Antibody

Anti-RELT Antibody

Target: RELT tumor necrosis factor receptor
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human RELT, a tumor necrosis factor receptor family member.


Alternative Gene Names

  • FLJ14993
  • TNFRSF19L

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RELT tumor necrosis factor receptor
Target Gene RELT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHIC
Verified Species Reactivity Human
Interspecies Identity Mouse (92%), Rat (90%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.