CacheBy
Atlas Antibodies Anti-RELA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RELA Antibody

상품 한눈에 보기

Human RELA 단백질을 인식하는 Rabbit Polyclonal 항체로, NFKB3(p65)로도 알려진 RELA 단백질 검출에 사용됩니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. PBS와 글리세롤 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063461-100 Anti-RELA Antibody, v-rel avian reticuloendotheliosis viral oncogene homolog A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063461-25 Anti-RELA Antibody, v-rel avian reticuloendotheliosis viral oncogene homolog A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RELA Antibody

Anti-RELA Antibody

Target: v-rel avian reticuloendotheliosis viral oncogene homolog A (RELA)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human RELA (NFKB3, p65).
Affinity purified using the PrEST antigen as affinity ligand.


  • Immunocytochemistry (ICC)

Target Information

항목 내용
Target Protein v-rel avian reticuloendotheliosis viral oncogene homolog A
Target Gene RELA
Alternative Gene Names NFKB3, p65
Antigen Sequence GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000030888 100%
Mouse ENSMUSG00000024927 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Open Datasheet


제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.