
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RELA Antibody
상품 한눈에 보기
Human RELA 단백질을 인식하는 Rabbit Polyclonal 항체로, NFKB3(p65)로도 알려진 RELA 단백질 검출에 사용됩니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. PBS와 글리세롤 버퍼에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063461-100 Anti-RELA Antibody, v-rel avian reticuloendotheliosis viral oncogene homolog A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063461-25 Anti-RELA Antibody, v-rel avian reticuloendotheliosis viral oncogene homolog A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RELA Antibody
Anti-RELA Antibody
Target: v-rel avian reticuloendotheliosis viral oncogene homolog A (RELA)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human RELA (NFKB3, p65).
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunocytochemistry (ICC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | v-rel avian reticuloendotheliosis viral oncogene homolog A |
| Target Gene | RELA |
| Alternative Gene Names | NFKB3, p65 |
| Antigen Sequence | GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Rat | ENSRNOG00000030888 | 100% |
| Mouse | ENSMUSG00000024927 | 98% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Related Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



