Atlas Antibodies Anti-RCC1 Antibody

상품 한눈에 보기

Human RCC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에 대한 검증 완료 및 마우스·랫트와 90% 서열 유사성을 가집니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027574-100 Anti-RCC1 Antibody, regulator of chromosome condensation 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027574-25 Anti-RCC1 Antibody, regulator of chromosome condensation 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RCC1 Antibody

Anti-RCC1 Antibody

Regulator of Chromosome Condensation 1 (RCC1)

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Independent Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RCC1

Alternative Gene Names

CHC1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	Regulator of Chromosome Condensation 1
Target Gene	RCC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000028896 (90%), Rat ENSRNOG00000050106 (90%)