CacheBy
Atlas Antibodies Anti-RCC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RCC1 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-RCC1 폴리클로날 항체는 인간 RCC1 단백질을 특이적으로 인식합니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원으로 정제되었습니다. 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027573-100 Anti-RCC1 Antibody, regulator of chromosome condensation 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027573-25 Anti-RCC1 Antibody, regulator of chromosome condensation 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RCC1 Antibody

Anti-RCC1 Antibody

Regulator of Chromosome Condensation 1 (RCC1)
Polyclonal Antibody against Human RCC1

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Independent validation by comparing antibodies targeting different epitopes
  • Immunocytochemistry (ICC)

Product Description

  • Type: Polyclonal Antibody
  • Target Protein: Regulator of chromosome condensation 1
  • Target Gene: RCC1
  • Alternative Gene Names: CHC1
  • Host: Rabbit
  • Isotype: IgG
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000050106 (90%)
    • Mouse ENSMUSG00000028896 (90%)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
  • Purification Method: Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.