원본
Thermo Fisher Scientific HDGF Polyclonal Antibody
상품 한눈에 보기
HDGF 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용에 적합. 고순도 항원 친화 크로마토그래피 정제. 동결건조 형태로 제공되며 -20°C 보관.
- 카탈로그번호
- PA579355
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 03:08
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579355 HDGF Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific HDGF Polyclonal Antibody
Applications 및 권장 희석 배수
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61–97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746471 |
Product Specific Information
재구성 시 증류수 0.2 mL을 첨가하면 최종 농도 500 µg/mL로 조제됩니다.
Target Information
HDGF (Hepatoma-Derived Growth Factor)는 hepatoma-derived growth factor 패밀리에 속하며, 세포 증식 및 분화에 관여하는 mitogenic 및 DNA 결합 활성을 지닌 단백질입니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific TIM-3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HEXA Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HDAC8 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HDAC11 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.