CacheBy
Thermo Fisher Scientific HDGF Polyclonal Antibody
원본

Thermo Fisher Scientific HDGF Polyclonal Antibody

상품 한눈에 보기

HDGF 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용에 적합. 고순도 항원 친화 크로마토그래피 정제. 동결건조 형태로 제공되며 -20°C 보관.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 03:08
Thermo Fisher Scientific PA579355 HDGF Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific HDGF Polyclonal Antibody

Applications 및 권장 희석 배수

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61–97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Wet ice
RRID AB_2746471

Product Specific Information

재구성 시 증류수 0.2 mL을 첨가하면 최종 농도 500 µg/mL로 조제됩니다.

Target Information

HDGF (Hepatoma-Derived Growth Factor)는 hepatoma-derived growth factor 패밀리에 속하며, 세포 증식 및 분화에 관여하는 mitogenic 및 DNA 결합 활성을 지닌 단백질입니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.