CacheBy
Atlas Antibodies Anti-RAB31 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAB31 Antibody

상품 한눈에 보기

Human RAB31 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 품질을 제공합니다. Rabbit 유래 IgG로 높은 특이성과 재현성을 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019717-100 Anti-RAB31 Antibody, RAB31, member RAS oncogene family 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019717-25 Anti-RAB31 Antibody, RAB31, member RAS oncogene family 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB31 Antibody

Anti-RAB31 Antibody

RAB31, member RAS oncogene family


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human RAB31

Alternative Gene Names

Rab22B

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RAB31, member RAS oncogene family
Target Gene RAB31
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000042189 (85%), Mouse ENSMUSG00000056515 (85%)

Antigen Sequence:

LKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.