CacheBy
Atlas Antibodies Anti-RAB32 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAB32 Antibody

상품 한눈에 보기

인간 RAB32 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 WB Orthogonal 검증에 적합하며, PrEST 항원으로 정제되었습니다. 고순도 및 높은 특이성을 제공하여 신뢰성 있는 단백질 발현 분석에 활용 가능합니다.

카탈로그번호
HPA025731-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025731-100 Anti-RAB32 Antibody, RAB32, member RAS oncogene family 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025731-25 Anti-RAB32 Antibody, RAB32, member RAS oncogene family 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB32 Antibody

Anti-RAB32 Antibody

Target: RAB32, member of RAS oncogene family
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation: Protein expression validated using WB by comparison to RNA-seq data of the corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human RAB32
Open Datasheet


Target Information

항목 내용
Target Protein RAB32, member RAS oncogene family
Target Gene RAB32
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000014258 (72%), Mouse ENSMUSG00000019832 (69%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.