원본

Atlas Antibodies Anti-PTPRS Antibody

상품 한눈에 보기

Human PTPRS 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 연구 응용에 적합. 40% glycerol 기반 PBS buffer에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054747-100 Anti-PTPRS Antibody, protein tyrosine phosphatase, receptor type, S 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054747-25 Anti-PTPRS Antibody, protein tyrosine phosphatase, receptor type, S 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Protein tyrosine phosphatase, receptor type, S
Target Gene: PTPRS
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
KPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHK
```

Highest antigen sequence identity to the following orthologs:

Polyclonal Antibody against Human PTPRS
Open Datasheet (PDF)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand