CacheBy
Atlas Antibodies Anti-PTPRQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPRQ Antibody

상품 한눈에 보기

Human PTPRQ 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053245-100 Anti-PTPRQ Antibody, protein tyrosine phosphatase, receptor type, Q 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053245-25 Anti-PTPRQ Antibody, protein tyrosine phosphatase, receptor type, Q 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPRQ Antibody

Anti-PTPRQ Antibody

Target Protein: protein tyrosine phosphatase, receptor type, Q
Supplier: Atlas Antibodies


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human PTPRQ.


Alternative Gene Names

  • DFNB84

Open Datasheet


Target Information

항목 내용
Target Protein protein tyrosine phosphatase, receptor type, Q
Target Gene PTPRQ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AVITGPTCYLIDVKSVDNDEFNISFIKSNEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTK

Species Reactivity

항목 내용
Verified Species Human
Interspecies Identity Mouse ENSMUSG00000035916 (85%)
Rat ENSRNOG00000056915 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.