CacheBy
Atlas Antibodies Anti-PTK2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTK2B Antibody

상품 한눈에 보기

Human PTK2B 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 실험에 적합하며 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA026276-100 Anti-PTK2B Antibody, protein tyrosine kinase 2 beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026276-25 Anti-PTK2B Antibody, protein tyrosine kinase 2 beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTK2B Antibody

Anti-PTK2B Antibody

Protein tyrosine kinase 2 beta (PTK2B)
Polyclonal Antibody against Human PTK2B


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

  • Type: Polyclonal antibody
  • Target Protein: Protein tyrosine kinase 2 beta
  • Target Gene: PTK2B
  • Alternative Gene Names: CADTK, CAKB, FAK2, PTK, PYK2, RAFTK
  • Host: Rabbit
  • Isotype: IgG
  • Verified Species Reactivity: Human, Rat

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM

Interspecies Information:
| Species | Gene ID | Sequence Identity |
|----------|----------|-------------------|
| Rat | ENSRNOG00000027839 | 90% |
| Mouse | ENSMUSG00000059456 | 88% |


Purification and Buffer

항목 내용
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.