AI 생성

1 / 2

Atlas Antibodies Anti-PTHLH Antibody

상품 한눈에 보기

인간 PTHLH 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 지원. 토끼 유래 IgG, PrEST 항원으로 정제된 제품.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035982-100 Anti-PTHLH Antibody, parathyroid hormone-like hormone 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035982-25 Anti-PTHLH Antibody, parathyroid hormone-like hormone 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Parathyroid hormone-like hormone (PTHLH)
Supplier: Atlas Antibodies

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal antibody against human PTHLH.

HHM, PLP, PTHR, PTHRP

항목	내용
Target Protein	Parathyroid hormone-like hormone
Target Gene	PTHLH
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000048776 (91%), Rat ENSRNOG00000011566 (24%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

KRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGL

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.