CacheBy
Atlas Antibodies Anti-PTGES3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTGES3 Antibody

상품 한눈에 보기

Human PTGES3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 독립 항체 간 비교로 검증된 신뢰성 높은 제품이며, Human, Mouse, Rat에 반응합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038673-100 Anti-PTGES3 Antibody, prostaglandin E synthase 3 (cytosolic) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038673-25 Anti-PTGES3 Antibody, prostaglandin E synthase 3 (cytosolic) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTGES3 Antibody

Anti-PTGES3 Antibody

Target: prostaglandin E synthase 3 (cytosolic)

  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human PTGES3

Alternative Gene Names

cPGES, p23, TEBP

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein prostaglandin E synthase 3 (cytosolic)
Target Gene PTGES3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDD
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000002642 (97%), Mouse ENSMUSG00000071072 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.