Atlas Antibodies Anti-PTGES3 Antibody

상품 한눈에 보기

Human PTGES3 단백질을 인식하는 고품질 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교를 통한 검증 완료. 높은 종간 반응성(인간, 마우스, 랫트) 보유. 친화 정제된 고순도 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038672-100 Anti-PTGES3 Antibody, prostaglandin E synthase 3 (cytosolic) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038672-25 Anti-PTGES3 Antibody, prostaglandin E synthase 3 (cytosolic) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: prostaglandin E synthase 3 (cytosolic)
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in Western blot by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Polyclonal Antibody against Human PTGES3

cPGES, p23, TEBP

항목	내용
Target Protein	prostaglandin E synthase 3 (cytosolic)
Target Gene	PTGES3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDD
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000071072 (97%), Rat ENSRNOG00000002642 (97%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand