Atlas Antibodies Anti-CPB1 Antibody

상품 한눈에 보기

인체 CPB1 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 정량 분석에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 완료. PrEST 항원으로 정제되어 높은 특이성과 재현성을 보장. Human 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046340-100 Anti-CPB1 Antibody, carboxypeptidase B1 (tissue) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046340-25 Anti-CPB1 Antibody, carboxypeptidase B1 (tissue) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: carboxypeptidase B1 (tissue)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human CPB1.

항목	내용
Target Protein	carboxypeptidase B1 (tissue)
Target Gene	CPB1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LQYKVLISNLRNVVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGF
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000030904 (72%), Mouse ENSMUSG00000011463 (66%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet