CacheBy
Atlas Antibodies Anti-CPA5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPA5 Antibody

상품 한눈에 보기

Human CPA5 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 Affinity purification 되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020322-100 Anti-CPA5 Antibody, carboxypeptidase A5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020322-25 Anti-CPA5 Antibody, carboxypeptidase A5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPA5 Antibody

Anti-CPA5 Antibody

Target Protein: Carboxypeptidase A5 (CPA5)
Supplier: Atlas Antibodies

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CPA5.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Carboxypeptidase A5
Target Gene CPA5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYHT
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000029788 (92%), Rat ENSRNOG00000010467 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.