CacheBy
Atlas Antibodies Anti-CPAMD8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPAMD8 Antibody

상품 한눈에 보기

인간 CPAMD8 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 PBS 완충액에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031327-100 Anti-CPAMD8 Antibody, C3 and PZP-like, alpha-2-macroglobulin domain containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031327-25 Anti-CPAMD8 Antibody, C3 and PZP-like, alpha-2-macroglobulin domain containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPAMD8 Antibody

Anti-CPAMD8 Antibody

C3 and PZP-like, alpha-2-macroglobulin domain containing 8

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human CPAMD8

Alternative Gene Names

K-CAP, KIAA1283, VIP

Open Datasheet

Target Information

항목 내용
Target Protein C3 and PZP-like, alpha-2-macroglobulin domain containing 8
Target Gene CPAMD8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000025453 (30%), Mouse ENSMUSG00000047228 (28%)

Antigen Sequence:
YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.