CacheBy
Atlas Antibodies Anti-CPA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPA3 Antibody

상품 한눈에 보기

Human CPA3 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 및 Orthogonal Validation에 적합합니다. PrEST 항원으로 Affinity 정제되었으며, Human에 특이적으로 반응합니다. 40% glycerol/PBS buffer에 보존된 고품질 연구용 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008689-100 Anti-CPA3 Antibody, carboxypeptidase A3 (mast cell) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008689-25 Anti-CPA3 Antibody, carboxypeptidase A3 (mast cell) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPA3 Antibody

Anti-CPA3 Antibody

Target: carboxypeptidase A3 (mast cell)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CPA3
Open Datasheet

Target Information

항목 내용
Target Protein carboxypeptidase A3 (mast cell)
Target Gene CPA3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011181 (77%), Mouse ENSMUSG00000001865 (75%)

Antigen Sequence

RFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNER

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.