CacheBy
Atlas Antibodies Anti-COX8C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COX8C Antibody

상품 한눈에 보기

인간 COX8C 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 단백질 발현 검증 완료. 토끼 유래 IgG 항체이며, 프레스티 항원으로 친화 정제됨. PBS 완충액과 글리세롤, 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003127-100 Anti-COX8C Antibody, cytochrome c oxidase subunit VIIIC 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003127-25 Anti-COX8C Antibody, cytochrome c oxidase subunit VIIIC 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COX8C Antibody

Anti-COX8C Antibody

Target: Cytochrome c oxidase subunit VIIIC
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal Antibody against Human COX8C


Alternative Gene Names

  • COX8-3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Cytochrome c oxidase subunit VIIIC
Target Gene COX8C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000039633 (40%), Rat ENSRNOG00000053945 (35%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.