Atlas Antibodies Anti-COX7A2L Antibody

상품 한눈에 보기

Human COX7A2L 단백질을 인식하는 Rabbit Polyclonal 항체로, cytochrome c oxidase subunit VIIa polypeptide 2 like 단백질 검출에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 ICC 등 다양한 응용 가능.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059124-100 Anti-COX7A2L Antibody, cytochrome c oxidase subunit VIIa polypeptide 2 like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059124-25 Anti-COX7A2L Antibody, cytochrome c oxidase subunit VIIa polypeptide 2 like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-COX7A2L Antibody

Anti-COX7A2L Antibody

Target: cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L)
Supplier: Atlas Antibodies

Recommended Applications

면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human COX7A2L

Alternative Gene Names

COX7AR, COX7RP, EB1, SIG81

Open Datasheet

Target Information

항목	내용
Target Protein	cytochrome c oxidase subunit VIIa polypeptide 2 like
Target Gene	COX7A2L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000024248 (85%), Rat ENSRNOG00000004526 (58%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand