CacheBy
Atlas Antibodies Anti-COPG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COPG1 Antibody

상품 한눈에 보기

Human COPG1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체로 높은 특이성과 재현성을 제공. Affinity purified 방식으로 높은 순도 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037867-100 Anti-COPG1 Antibody, coatomer protein complex, subunit gamma 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037867-25 Anti-COPG1 Antibody, coatomer protein complex, subunit gamma 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COPG1 Antibody

Anti-COPG1 Antibody

Target: coatomer protein complex, subunit gamma 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Independent validation comparing antibodies targeting different epitopes
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human COPG1.


Alternative Gene Names

  • COPG

Open Datasheet


Target Information

항목 내용
Target Protein coatomer protein complex, subunit gamma 1
Target Gene COPG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030058 (99%), Rat ENSRNOG00000010474 (99%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.